CBL1 213 At4g17615 SOS3-like calcium-binding protein 5 CNBL1_ARATH Calcineurin B-like protein 1 Acts as a calcium sensor involved in the signaling pathway during growth and development and in response to abiotic stresses. May function as a positive regulator of salt and drought responses and as a negative regulator of cold response. Contributes to the regulation of early stress-related CBF/DREB transcription factors. CBL proteins interact with CIPK serine- threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner. Mediates the activation of AKT1 by CIPK proteins (CIPK6, CIPK16, and CIPK23) in response to low potassium conditions and in the context of stomatal movement. MGCFHSKAAKEFRGHEDPVKLASETAFSVSEVEALFELFKSISSSVVDDGLINKEEFQLALFKSRKRENIFANRIFDMFDVKRKGVIDFGDFVRSLNVFHPNASLEDKIDFTFRLYDMDCTGYIERQEVKQMLIALLCESEMKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPSFVFHSEVDEIAT FCAALL.122 dl4845w SCABP5